PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678353272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family FAR1
Protein Properties Length: 760aa    MW: 86741.2 Da    PI: 7.4047
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678353272genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR181.61.4e-2530116191
       FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                ++Y++YAk+vGF + k +s++s+ ++e+++++f C ++g+r++++++     ++r++ ++gCka+++vk++ +gkw+++++++eHnH+l p
  678353272  30 EYYRHYAKSVGFGTAKLSSRRSRASKEFIDAKFSCIRYGNRQQSDDA----INPRPSPKIGCKASMHVKRKPSGKWYIHTFVKEHNHDLLP 116
                69****************************************99888....9************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-2330116IPR004330FAR1 DNA binding domain
PfamPF105512.5E-22230321IPR018289MULE transposase domain
PROSITE profilePS5096610.249510546IPR007527Zinc finger, SWIM-type
PfamPF044342.4E-9516544IPR007527Zinc finger, SWIM-type
SMARTSM005751.5E-6521548IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MESGSRDEVN STNLEPTHDV EFDSHEAAYE YYRHYAKSVG FGTAKLSSRR SRASKEFIDA  60
KFSCIRYGNR QQSDDAINPR PSPKIGCKAS MHVKRKPSGK WYIHTFVKEH NHDLLPAQVH  120
FFRSHKSTDT SNSDFKTRKK KVVSGGLNQF GIYQFPSSSI ENVIRNQHDK GRFLNLEDGD  180
AQVVLEFCEH MHHENPNFVY AIDLNEGHRL RNIFWVDAKG LEDYAYFGDV VSFDTTYFVN  240
KYRVPLVIFV GVNHHMQPTL FGCALIADLT LHTFVWLMQS WYFAMGGRSP KVLLSDQNET  300
IKAAVQFVLP ETHHFFHLWS VLEKIPRRVD YLSVWLETIV KKLDKCIYRS WNEEQFDKRW  360
WKLIERCNLQ EDECMQSLYE DRKLWVPALM TNISFAGLSV ASRSESLNSL FDRYIHGETS  420
LMEFLGRYKS IIGDRYEEES KANFDAWHET PELKSPSPFE KQMQFIYTPE IFSKFQIEVL  480
GAAACHLKKE KEDGSIVLYV VKDFENNLDF MVKWDERGSD IHCSCCSFQY KGYLCRHAIV  540
VLQMSGVFSV PFKFVLQRWT NVATSKAPLS ERLEDVQAKV RRYNDLCRRA IILGEEGSLS  600
HESYNTACNA IHEALAQCSN KNKNCNNDPR LNLPTPPATQ VSPGLEHVNV FSSQQHPIVT  660
GATNAGGASK RANSDKEPGD CGGSGVSNKK GKSIIQVPID PQIASIGTQG IFQHMSQDTT  720
SQMDYAAAAL CPTRLLTTLL RGGELSKRGV EMLGQMLEHQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072523.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 4
RefseqXP_011072522.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 4
SwissprotQ6NQJ70.0FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLA0A022Q4D20.0A0A022Q4D2_ERYGU; Uncharacterized protein
STRINGSolyc03g121630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49621103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.10.0FAR1-related sequence 4